PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009127638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 401aa    MW: 45585.3 Da    PI: 5.2932
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009127638.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.66.1e-091458341
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                    +r C+ + + +++++C  ++ +lC++C  ++H+       H++v 
  XP_009127638.1 14 ARACDSCLKRRARWYCAADDAFLCHSCDGSIHSAnplarrHERVL 58
                    578*****************************6688888898875 PP

2CCT68.51.8e-23352395144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  XP_009127638.1 352 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 395
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.4241259IPR000315B-box-type zinc finger
SMARTSM003362.8E-121259IPR000315B-box-type zinc finger
PfamPF006437.3E-71458IPR000315B-box-type zinc finger
CDDcd000211.70E-81559No hitNo description
PROSITE profilePS5101716.083352394IPR010402CCT domain
PfamPF062035.2E-18352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MMKNSANVVG GKTARACDSC LKRRARWYCA ADDAFLCHSC DGSIHSANPL ARRHERVLLK  60
SASPGKQRHD SSSPPHPPTW HQGFTRKART RRGGKKSHTM IFHDLVPEMS SEDQSFEVEE  120
QLIFEVPVLN PMCHEKCLNE SMETKIELPL MSMCFKGSDE EDDNAESCLN GLFPTDTELA  180
QFSADVEILL GGGTDREYNM EELGLGEMLK VEKEEVEEEE EVATIEVCDL DAADEITPFV  240
ISFEYEYSQK TNLEEEDEKQ DVENNMIDVG VNEMSCSIKE EKNEKVHMLR LDYESVISTW  300
GGQGTPWTAR ETPQIDLNML CCPTDSMVES GGEAHHHNYV RGLGLHMGEA GREARVSRYR  360
EKRRTRLFSK KIRYEVRKLN AEKRPRMKGR FVKRSSIAAA H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362378RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127638.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLM4EYN30.0M4EYN3_BRARP; Uncharacterized protein
STRINGBra033925.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain